Name | TEX2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6889 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | TEX2 antibody was raised using the N terminal of TEX2 corresponding to a region with amino acids KSLSTEVEPKESPHPARHRHLMKTLVKSLSTDTSRQESDTVSYKPPDSKL |
Purity/Format | Affinity purified |
Blocking Peptide | TEX2 Blocking Peptide |
Description | Rabbit polyclonal TEX2 antibody raised against the N terminal of TEX2 |
Gene | TEX2 |
Supplier Page | Shop |