Elastase 1 antibody (Pancreatic)

• Supplier: Fitzgerald
• Catalog: 70R-4123
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Elastase 1 antibody (Pancreatic) was raised using the N terminal of ELA1 corresponding to a region with amino acids LVLYGHSTQDLPETNARVVGGTEAGRNSWPSQISLQYRSGGSRYHTCGGT
• Purity/Format: Affinity purified
• Blocking Peptide: Elastase 1 Blocking Peptide (Pancreatic)
• Description: Rabbit polyclonal Elastase 1 antibody (Pancreatic) raised against the N terminal of ELA1
• Gene: CELA1