CXORF34 antibody

• Supplier: Fitzgerald
• Catalog: 70R-1205
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: CXORF34 Blocking Peptide
• Description: Rabbit polyclonal CXORF34 antibody raised against the middle region of Cxorf34
• Gene: TRMT2B