Anti-CFDP1 antibody
| Name | Anti-CFDP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab135342 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human |
| Antigen | A synthetic peptide corresponding to a region within C terminal amino acids 235-284 (STLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLERVDHRQFE I) of Rat CFDP1 (NP_955410) |
| Description | Rabbit Polyclonal |
| Gene | CFDP1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CFDP1 antibody (ab135342) at 1 µg/ml + Rat spleen lysate at 10 µg