Anti-CKLF antibody
| Name | Anti-CKLF antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86264 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 of Human CKLF ( DNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGF ); NP_001035228 Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | CKLF |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CKLF antibody (ab86264) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution