Anti-Clarin-2 antibody
| Name | Anti-Clarin-2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122790 |
| Prices | $443.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P ICC/IF ICC/IF |
| Species Reactivities | Human |
| Antigen | antigen sequence: VKFHDLTERIANFQEKLFQFVVVEEQYEES , corresponding to internal sequence amino acids 159-188 of Human Clarin-2 |
| Description | Rabbit Polyclonal |
| Gene | CLRN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Immunofluorescent staining of Human cell line U-251 MG shows positivity in cytoplasm and cytoskeleton (intermediate filaments). Recommended concentration of ab122790 1-4 µg/ml. Cells treated with PFA/Triton X-100.
ab122790, at 1/200 dilution, staining Clarin-2 in paraffin-embedded Human liver tissue by Immunohistochemistry.