Anti-Claudin18 antibody
| Name | Anti-Claudin18 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98071 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 143-192 ( LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM ) of Human Claudin18 (NP_001002026) |
| Description | Rabbit Polyclonal |
| Gene | CLDN18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Claudin18 antibody (ab98071) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 Cell Lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG