Anti-COBLL1 antibody

Name Anti-COBLL1 antibody
Supplier Abcam
Catalog ab99104
Prices $370.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human, Rabbit
Antigen Synthetic peptide corresponding to a region within internal amino acids 899-948 ( QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP ) of Human COBLL1 (NP_055715)
Description Rabbit Polyclonal
Gene COBLL1
Conjugate Unconjugated
Supplier Page Shop

Product images