Anti-Connexin 59/GJA10 antibody
| Name | Anti-Connexin 59/GJA10 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86414 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | A synthetic peptide corresponding to a region within amino acids 396 - 445 (DGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK G) of Human Connexin 59/GJA10 (NP_110399) |
| Description | Rabbit Polyclonal |
| Gene | GJA9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Connexin 59/GJA10 antibody (ab86414) at 1 µg/ml + Human fetal brain lysate at 10 µgSecondaryHRP-conjugated anti-Rabbit IgG at 1/50000 dilution