Anti-COQ5 antibody
| Name | Anti-COQ5 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122936 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Mouse, Rabbit, Horse, Bovine, Cat, Dog, Human, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 41-90 ( RSLSQEKRAAETHFGFETVSEKEKGGKVYQVFQSVARKYDLMNDMMSLG I) of Rat COQ5 (NP_001034111) |
| Description | Rabbit Polyclonal |
| Gene | COQ5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-COQ5 antibody (ab122936) at 1 µg/ml + Rat Lung lysate at 10 µg