Anti-CPNE2 antibody
| Name | Anti-CPNE2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab135343 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Human, Zebrafish |
| Antigen | A synthetic peptide corresponding to a region within N terminal amino acids 20-69 (QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAV N) of Mouse CPNE2 (NP_705727) |
| Description | Rabbit Polyclonal |
| Gene | CPNE2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CPNE2 antibody (ab135343) at 1 µg/ml + Mouse stomach lysate at 10 µg