Anti-CPXCR1 antibody
| Name | Anti-CPXCR1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87172 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 252-301 (GFVDILTYIHTMNVMITNTNNGWKYFCPICGRLFNTYSELRQHSCSSSG N) of Human CPXCR1 (NP_149037) |
| Description | Rabbit Polyclonal |
| Gene | CPXCR1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CPXCR1 antibody (ab87172) at 1 µg/ml + Fetal brain lysate (Human) at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution
ab87172 at 5 µg/ml staining CPXCR1 in Human testis tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).
ab87172 at 5 µg/ml staining CPXCR1 in Human thymus tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections).