Anti-Cyclin J antibody
| Name | Anti-Cyclin J antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab104895 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 71-120 FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL , of Human Cyclin J (NP_061957) |
| Description | Rabbit Polyclonal |
| Gene | CCNJ |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Cyclin J antibody (ab104895) at 1 µg/ml + 721_B cell lysate at 10 µg