Anti-CYP2C18 antibody
| Name | Anti-CYP2C18 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98026 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 1-50 ( MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM ) of Human CYP2C18 (NP_000763) |
| Description | Rabbit Polyclonal |
| Gene | CYP2C18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-CYP2C18 antibody (ab98026) at 1 µg/ml (in 5% skim milk / PBS buffer) + HT1080 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution