Anti-Cytochrome P450 3A4 antibody
| Name | Anti-Cytochrome P450 3A4 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab98319 |
| Prices | $376.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Sheep, Rabbit, Goat, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Monkey |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 395-444 (MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCI G) of Human Cytochrome P450 3A4 (NP_059488) |
| Description | Rabbit Polyclonal |
| Gene | CYP3A4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Cytochrome P450 3A4 antibody (ab98319) at 1 µg/ml (5% skim milk/PBS buffer) + THP-1 cell lysate at 10 µg