Anti-DAP1 antibody
| Name | Anti-DAP1 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab122933 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 50-99 ( PSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQ ) of Human DAP1 (NP_004385) |
| Description | Rabbit Polyclonal |
| Gene | DAP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DAP1 antibody (ab122933) at 1 µg/ml + HCT15 cell lysate at 10 µg