Anti-DAZ3 antibody
| Name | Anti-DAZ3 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94695 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rat, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 216-265 ( FPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFP ) of Human DAZ3 (NP_065097) |
| Description | Rabbit Polyclonal |
| Gene | DAZ3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DAZ3 antibody (ab94695) at 1 µg/ml + OVCAR3 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution