Anti-DDX51 antibody
| Name | Anti-DDX51 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108179 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Guinea Pig, Bovine, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 301-350 (FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGR L) of Human DDX51 (NP_778236) |
| Description | Rabbit Polyclonal |
| Gene | DDX51 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DDX51 antibody (ab108179) at 1 µg/ml + 293T cell lysate at 10 µg