Anti-DENND2C antibody
| Name | Anti-DENND2C antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab87164 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 360 - 409 ( IFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQ ) of Human DENND2C (NP_940861) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | DENND2C |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DENND2C antibody (ab87164) at 1 µg/ml (in 5% skim milk / PBS buffer) + transfected 293T cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution