Anti-DHX34 antibody
| Name | Anti-DHX34 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab94989 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 1094-1143 ( PQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQHV ) of Human DHX34 (NP_055496) |
| Description | Rabbit Polyclonal |
| Gene | DHX34 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DHX34 antibody (ab94989) at 1 µg/ml (in 5% skim milk / PBS buffer) + THP-1 cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution