Anti-DHX35 antibody
| Name | Anti-DHX35 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab86677 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog, Pig |
| Antigen | Synthetic peptide corresponding to a region within N-terminal amino acids 1 - 50 (AAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ R) of Human DHX35 (NP_068750) |
| Description | Rabbit Polyclonal |
| Gene | DHX35 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DHX35 antibody (ab86677) at 1 µg/ml + Human fetal heart lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution