Anti-DHX57 antibody
| Name | Anti-DHX57 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab108178 |
| Prices | $359.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within C terminal amino acids 1151-1200 ( LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG ) of Human DHX57 (NP_945314) |
| Description | Rabbit Polyclonal |
| Gene | DHX57 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DHX57 antibody (ab108178) at 1 µg/ml + HepG2 cell lysate at 10 µg