Anti-DIRC2 antibody
| Name | Anti-DIRC2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85188 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Guinea Pig |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 216-265 of Human DIRC2 (DIRC2 AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ ) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | DIRC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DIRC2 antibody (ab85188) at 1 µg/ml + MCF7 Cell Lysate at 10 µg