Anti-Dmrtc2 antibody
| Name | Anti-Dmrtc2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab85597 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 of Human Dmrtc2; VLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQ (NP_001035373) Run BLAST with Run BLAST with |
| Description | Rabbit Polyclonal |
| Gene | DMRTC2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Dmrtc2 antibody (ab85597) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µgSecondaryHRP conjugated anti-Rabbit IgG at 1/50000 dilution