Anti-DNA Polymerase gamma antibody
| Name | Anti-DNA Polymerase gamma antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab116049 |
| Prices | $378.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Rat, Human, Mouse, Horse, Guinea Pig, Bovine, Cat, Dog, Zebrafish |
| Antigen | Synthetic peptide corresponding to a region within N terminal amino acids 242-291 ( QDWQEQLVVGHNVSFDRAHIREQYLIQGSRMHFLDTMSMHMAISGLSSFQ ) of Rat DNA Polymerase gamma (NP_445980) |
| Description | Rabbit Polyclonal |
| Gene | POLG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DNA Polymerase gamma antibody (ab116049) at 1 µg/ml + Rat lung lysate at 10 µg