Anti-DOK6 antibody
| Name | Anti-DOK6 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab102621 |
| Prices | $370.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal sequence amino acids 281-330 ( IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI ) of Human DOK6 (NP_689934) |
| Description | Rabbit Polyclonal |
| Gene | DOK6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-DOK6 antibody (ab102621) at 1 µg/ml + COLO205 cell lysate at 10 µg