Human EEA1 protein fragment
| Name | Human EEA1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab112379 |
| Category | Protein |
| Applications | WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | This product is useful for Antibody Production and Protein Array |
| SwissProt/Accession | Q15075 |
| Gene | EEA1 |
| Residue | 1312 to 1411 |
| Sequence | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMAC GKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
| Supplier Page | Shop |
Product images
ab112379 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue