Name | GPSM2 fusion protein |
---|---|
Supplier | Proteintech Group |
Catalog | Ag25195 |
Category | Protein |
Prices | $199.00 |
Sizes | 50 μg |
Species Reactivities | Human |
Source | E. coli -derived, PGEX-4T |
Tag/Conjugation | gst |
Purity | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Bioactivity | Not tested. |
Endotoxin | Please contact the lab for more information. |
Gene | GPSM2 |
Sequence | FSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDILVKCQGS (559 - 600 aa encoded by BC027732 ) |
Supplier Page | Shop |