Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1

Name Recombinant Homo sapiens Mediator of DNA damage checkpoint protein 1
Supplier Cusabio
Catalog CSB-EP623929HU
Category Protein
Species Reactivities Human
Nature Recombinant
Tag/Conjugation His-SUMO-tag
Purity Greater than 90% as determined by SDS-PAGE.
SwissProt/Accession Q14676
Gene MDC1
Residue 1892-2082aa
Sequence APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
Description Partial
Supplier Page Shop

Product images