Human EMP3 protein fragment
| Name | Human EMP3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab117021 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P54852 |
| Gene | EMP3 |
| Residue | 25 to 68 |
| Sequence | DKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQV |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab117021 at approximately 30.47 kDa. Stained with Coomassie Blue.