Human Eotaxin 2 full length protein
| Name | Human Eotaxin 2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab195064 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Mammalian |
| Tag/Conjugation | StrepII tag N-Terminus |
| Purity | >90% by SDS-PAGE. Chemically-defined, serum- and animal-product-free culture medium. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | O00175 |
| Gene | CCL24 |
| Residue | 27 to 119 |
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
| Supplier Page | Shop |
Product images
SDS-PAGE of 2 μg ab195064.