ZNF444 Recombinant Protein Antigen

Name ZNF444 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33802PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF444 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF444
Sequence MEVAVPVKQEAEGLALDSPWHRFRRFHLGD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF444
Supplier Page Shop