cleavage stimulation factor Recombinant Protein Antigen

Name cleavage stimulation factor Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33486PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody cleavage stimulation factor Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CSTF1
Sequence TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSTF1
Supplier Page Shop