Name | ORF1 FL49 Recombinant Protein Antigen |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP2-13898PEP |
Category | Protein |
Prices | $199.00 |
Sizes | 100 µl |
For Antibody | ORF1 FL49 Antibody |
Species Reactivities | Human |
Nature | Recombinant |
Source | E.coli |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Gene | CYSTM1 |
Sequence | QPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELG |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYSTM1 |
Supplier Page | Shop |