CCL1/I-309/TCA-3 Recombinant Protein Antigen

Name CCL1/I-309/TCA-3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-14459PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCL1/I-309/TCA-3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCL1
Sequence RAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCL1
Supplier Page Shop