PARP16 Recombinant Protein Antigen

Name PARP16 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-94123PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PARP16 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PARP16
Sequence SYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEY
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PARP16
Supplier Page Shop