TTMP Recombinant Protein Antigen

Name TTMP Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-93935PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TTMP Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C3orf52
Sequence LSSNKTFFIMLKIPEECVAEEELPHLLTERLTDVYSTSPSLSRYFTSVEIVDFSGENATVTYDLQFGVPSDDENFMKYMMSEELVLGILLQDFRDQNIPGCESLGLDP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C3orf52
Supplier Page Shop