CCDC67 Recombinant Protein Antigen

Name CCDC67 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-93920PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCDC67 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCDC67
Sequence MKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQTHLISLDAQQKLLSEKCNQFQKQAQSYQTQLNGKKQCLEDSSSEIPRLICDPDPNCEINERDEFIIEKLKSAVNEIALSRNKLQD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCDC67
Supplier Page Shop