CHCHD10 Recombinant Protein Antigen

Name CHCHD10 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-91169PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CHCHD10 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CHCHD10
Sequence GLMAQMATTAAGVAVGSAVGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHCHD10
Supplier Page Shop