SPATA13 Recombinant Protein Antigen

Name SPATA13 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-90849PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SPATA13 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SPATA13
Sequence ALRPAEWGTLDGSDLEDTDDAFQRSTHRSRSLRRAYGLGRICLLDAPQNHATPTIATGQVPAVCEILVRDPENNSMGYRRSKSTDNLAFLKKSSFKRKSTSNLADLRTAH
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPATA13
Supplier Page Shop