Adenylate Cyclase 2 Recombinant Protein Antigen

Name Adenylate Cyclase 2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-90281PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Adenylate Cyclase 2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ADCY2
Sequence HHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADCY2
Supplier Page Shop