COL15A1 Recombinant Protein Antigen

Name COL15A1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-91087PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody COL15A1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene COL15A1
Sequence MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL15A1
Supplier Page Shop