SEZ6/BSRP-C Recombinant Protein Antigen

Name SEZ6/BSRP-C Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-90945PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SEZ6/BSRP-C Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SEZ6
Sequence PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEZ6
Supplier Page Shop