MGC16471 Recombinant Protein Antigen

Name MGC16471 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88005PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MGC16471 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TAMM41
Sequence MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAMM41
Supplier Page Shop