ICT Recombinant Protein Antigen

Name ICT Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87963PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ICT Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ICT1
Sequence TEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ICT1
Supplier Page Shop