Cerberus 1 Recombinant Protein Antigen

Name Cerberus 1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88030PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Cerberus 1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C3CER1
Sequence SDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVILPIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CER1
Supplier Page Shop