RP105/CD180 Recombinant Protein Antigen

Name RP105/CD180 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87727PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RP105/CD180 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CD180
Sequence DFQNNAIHYISREDMRSLEQAINLSLNFNGNNVKGIELGAFDSTVFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD180
Supplier Page Shop