SLC25A31 Recombinant Protein Antigen

Name SLC25A31 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89074PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SLC25A31 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC25A31
Sequence FARTRLGVDIGKGPEERQFKGLGDCIMKIAKSDGIAGLYQGFGVSVQGIIVYRA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC25A31
Supplier Page Shop