FAM160B1 Recombinant Protein Antigen

Name FAM160B1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88970PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody FAM160B1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene FAM160B1
Sequence CGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAM160B1
Supplier Page Shop