VISTA/B7-H5/PD-1H Recombinant Protein Antigen

Name VISTA/B7-H5/PD-1H Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88967PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody VISTA/B7-H5/PD-1H Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C10orf54
Sequence LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C10ORF54
Supplier Page Shop